- Recombinant Saccharomyces cerevisiae ATP synthase subunit K, mitochondrial (ATP19)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1007062
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,534 Da
- E Coli or Yeast
- 24838
- ATP synthase subunit K, mitochondrial (ATP19)
Sequence
MGAAYHFMGKAIPPHQLAIGTLGLLGLLVVPNPFKSAKPKTVDIKTDNKDEEKFIENYLKKHSEKQDA